VIP (peptide intestinal vasoactif)
VIP is a 28-amino-acid peptide hormone acting as both hormone and neurotransmitter. It induces vasodilation, stimulates heart contractility, relaxes smooth muscles, modulates gastrointestinal function, influences circadian rhythms, and demonstrates anti-inflammatory and immunomodulatory properties. Studied for autoimmune conditions, brain health, and infection control. Available as lyophilized powder with ≥95% purity.
UGS disponibles
| Modèle | Spécifications | MOQ |
|---|---|---|
| vip-5 | 5ml | 1 flacon |
| vip-10 | 10ml | 1 flacon |
| vip-20 | 20ml | 1 flacon |
Aperçu du produit
VIP is produced in the gut, pancreas, and hypothalamus. It stimulates heart contractions, causes vasodilation, lowers blood pressure, increases glycogen breakdown, relaxes smooth muscle in the trachea, stomach, and gallbladder, and modulates GI motility and secretion. In the brain, it affects blood flow, melatonin production, and circadian rhythm.
Mécanisme d'action
VIP binds to VPAC1 and VPAC2 receptors, triggering G-alpha-mediated signaling cascades that increase cAMP and PKA activity. PKA then activates transcriptional factors including CREB, and regulates molecular clock genes Per1 and Per2 for circadian rhythm modulation. VIP is co-released with GABA, influencing neural synchronization.
Principaux avantages
Anti-Inflammatory — Decreases most inflammatory cytokines. Shows anti-inflammatory effects in arthritis models and may support immune tolerance by suppressing Th1 and promoting Th2 responses.
Immune Balance — Studied for autoimmune/inflammatory diseases including rheumatoid arthritis, ulcerative colitis, multiple sclerosis, Parkinson's disease, and Crohn's disease.
Brain Health — Neuroprotective properties that increase cellular resistance against oxidative stress, support neuronal survival, and exert anti-anxiety effects.
Antimicrobial Activity — Displays antimicrobial properties against various pathogens including Streptococcus, E. coli, Pseudomonas, and Candida in laboratory studies.
Metabolic Regulation — Influences blood glucose, insulin, and leptin levels. VIP-deficient models show elevated glucose and enhanced sweet taste preference linked to leptin resistance.
Références
- Vosko AM, et al. Vasoactive intestinal peptide and the mammalian circadian system. *Gen Comp Endocrinol.* 2007;152(2–3):165–175.
- Maduna T, Lelievre V. Neuropeptides shaping the CNS development: spatiotemporal actions of VIP and PACAP. *J Neurosci Res.* 2016;94(12):1472–1487.
- Kingsbury MA. New perspectives on VIP as a widespread modulator of social behavior. *Curr Opin Behav Sci.* 2015;6:139–147.
| Numéro CAS | 40077-57-4 |
|---|---|
| Formule moléculaire | C147H237N43O43S |
| Poids moléculaire | 3326.82 g/mol |
| Séquence/Composition | HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2 |
| Acides aminés | 28 |
| Formulaire | Poudre lyophilisée |
| La pureté | ≥99% par HPLC |
| Stockage | -20°C desséché |
Produits apparentés
En vedette
BPC-157
BPC-157 est un pentadécapeptide synthétique dérivé d'une protéine protectrice...
Voir les détails →
En vedette
TB-500 (acétate de thymosine bêta-4)
TB-500 est un heptapeptide synthétique dérivé de la thymosine bêta-4, un...
Voir les détails →
KPV (Lys-Pro-Val)
Le KPV est un tripeptide (lysine-proline-valine) dérivé du fragment C-terminal...
Voir les détails →Besoin d'un OEM ou d'une configuration personnalisée ?
Nous proposons des synthèses sur mesure, des modifications et des services OEM. Faites-nous part de vos exigences, notamment en matière de séquence, de pureté, de quantité et de besoins particuliers. Notre équipe vous fournira un devis détaillé.